Abc-Type Uncharacterized Transport System Periplasmic Component-Like Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Abc-Type Uncharacterized Transport System Periplasmic Component-Like Protein
  Conformer 1
(PDB) 		6k1x (A)
  Conformer 2
(PDB) 		6k1y (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 127 0.62   29 - 146   156 - 157   173 - 179
2 21 0.5   147 - 155   158 - 172

Sequence


           _____________________________________________________________________________________________________________________146 
 6k1x(A) : EVTPIQQLFLIKELKPGIARIGVIWDKNAANRDEVLPQLQRASAATGIKVVVAEVASLQEVAPQFRTLLRDHQVEALWVLEESGLLGQAAARSFLIKNATQAGMPVFAPSETWLKEGACV 
         :                                                                                                                          
 6k1y(A) : EVTPIQQLFLIKELKPGIARIGVIWDKNAANRDEVLPQLQRASAATGIKVVVAEVASLQEVAPQFRTLLRDHQVEALWVLEESGLLGQAAARSFLIKNATQAGMPVFAPSETWLKEGACV 
           _____________________________________________________________________________________________________________________146 

           ______155______________172____________                                                                                   
 6k1x(A) : TWRK---gIRLVVNKAVAEAMGITIPAKYQDRTAFLAM                                                                                   
         :                                                                                                                          
 6k1y(A) : TWRKDAEGIRLVVNKAVAEAMGITIPAKYQDRTAF***                                                                                   
           ______155______________172____________                                                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.4
Translation
(A) 		-0.1
Closure
(%) 		100.0
Bending Residues
( green ) 		  146 - 147
  155 - 158
  172 - 173
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download