Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5sy1 (C)
  Conformer 2
(PDB) 		3wfn (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 43 1.93   4 - 29   31 - 31   62 - 77
2 27 1.63   30 - 30   32 - 61
3 25 1.85   83 - 101   131 - 137
4 37 2.86   102 - 130   138 - 145

Sequence


           _____________________________29_________________________56___________________77_____________________101_________________ 
 5sy1(C) : ***ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLT 
         :                                                                                                                          
 3wfn(C) : HHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV----nGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT 
           _____________________________29_________________________56___________________77_____________________101_________________ 

           _________130____137________________________________                                                                      
 5sy1(C) : DEEVDEMIREADIDGDGQVNYEEFVTMMTS*********************                                                                      
         :                                                                                                                          
 3wfn(C) : DEEVDEMIREADID-dGQVNYEEFVQMMTgEEVSAVVLQRAYRGHLARRGF                                                                      
           _________130____137________________________________                                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 60.1 1.7 93.0   29 - 32   56 - 63 Bending Region Analysis
1 3 149.3 -10.1 96.8   77 - 83 Bending Region Analysis
3 4 39.5 1.9 92.9   101 - 102   130 - 132   137 - 138 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 3 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download