Dual Specificity Mitogen-Activated Protein Kinase Kinase 7

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Dual Specificity Mitogen-Activated Protein Kinase Kinase 7
  Conformer 1
(PDB) 		6yz4 (A)
  Conformer 2
(PDB) 		6yg7 (A)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 22 2.01   166 - 187
2 61 1.44   124 - 165   194 - 216
3 182 1.57   188 - 193   217 - 413

Sequence


           ___________________________________________165___________________187__________________________216_______________________ 
 6yz4(A) : KQTGYLTIGGQRYQAEINDLENLGEMG-gQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMT 
         :                                                                                                                          
 6yg7(A) : *QTGYLTIGGQRYQAEINDLENLGEMGSgQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMT 
           ___________________________________________165___________________187__________________________216_______________________ 

           ________________________________________________________________________________________________________________________ 
 6yz4(A) : VAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLgCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDF 
         :                                                                                                                          
 6yg7(A) : VAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGI-----cAAYMAPERIDPP------yDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDF 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________________                                                                      
 6yz4(A) : QSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP                                                                      
         :                                                                                                                          
 6yg7(A) : QSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTES*                                                                      
           ___________________________________________________                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 40.8 0.3 94.5   165 - 166 Bending Region Analysis
1 3 31.8 -0.5 13.9   187 - 193 Bending Region Analysis
3 2 15.4 -0.6 100.0   188 - 194   216 - 217 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download