Glucosamine 6-Phosphate Deaminase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glucosamine 6-Phosphate Deaminase
  Conformer 1
(PDB) 		1hot (A)
  Conformer 2
(PDB) 		1cd5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 185 0.58   6 - 136   157 - 202   237 - 244
2 24 0.56   137 - 147   152 - 156   203 - 210
3 40 0.66   148 - 151   211 - 231   245 - 259

Sequence


           ________________________________________________________________________________________________________________________ 
 1hot(A) : MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ 
         :                                                                                                                          
 1cd5(A) : MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ 
           ________________________________________________________________________________________________________________________ 

           _____________136______145________156___________________________________________202_____210__________________231_________ 
 1hot(A) : YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD 
         :                                                                                                                          
 1cd5(A) : YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD 
           _____________136______145________156___________________________________________202_____210__________________231_________ 

           _244______________________                                                                                               
 1hot(A) : EPSTMELKVKTLRYFNELEAENIKGL                                                                                               
         :                                                                                                                          
 1cd5(A) : EPSTMELKVKTLRYFNELEAENIKGL                                                                                               
           _244______________________                                                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 11.0 0.0 98.8   136 - 137   156 - 157   202 - 203 Bending Region Analysis
1 3 6.7 -0.7 77.7   231 - 237   244 - 245 Bending Region Analysis
3 2 9.4 -0.1 81.4   145 - 152   210 - 211 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download