Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		4l17 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 148 1.31   7 - 109   192 - 195   213 - 253
2 99 1.38   110 - 191   196 - 212

Sequence


           _________________________________________________________________________________________________________109____________ 
 2f36(A) : **TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQN-DKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPID 
         :                                                                                                                          
 4l17(A) : NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITYVREEVIDFSKPFMSLGISIMIKKGTPIE 
           _________________________________________________________________________________________________________110____________ 

           _____________________________________________________________________191_195_______________212__________________________ 
 2f36(A) : SADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTD--YALLMESTSIEYVTQRN-CNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQ 
         :                                                                                                                          
 4l17(A) : SAEDLSKQTEIAYGTLDSGSTKEFFRRSKICVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLN 
           _____________________________________________________________________194_198_______________216__________________________ 

           _____________________                                                                                                    
 2f36(A) : EEGKLHMMKEKWWRGNG-CPS                                                                                                    
         :                                                                                                                          
 4l17(A) : EQGLLDKLKNKWWYDKGEC**                                                                                                    
           _____________________                                                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.9
Translation
(A) 		0.4
Closure
(%) 		87.0
Bending Residues
( green ) 		  109 - 110
  191 - 192
  195 - 196
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download