Mast/stem Cell Growth Factor Receptor Kit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mast/stem Cell Growth Factor Receptor Kit
  Conformer 1
(PDB) 		8s13 (A)
  Conformer 2
(PDB) 		8s16 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 193 0.63   596 - 601   650 - 654   673 - 806   814 - 929
2 92 0.85   571 - 595   602 - 649   655 - 672   807 - 813

Sequence


           ____________________________________595___601_____________________________________________649____________________672____ 
 8s13(A) : EVQWKVVEESnYSYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAQGL------mTVAVKMLKPSAHSTEREALMSELKVLSYLGNHENIVNLLGACTHGGPTLVITEYCCYG 
         :                                                                                                                          
 8s16(A) : *********NNYSYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAQGLIKSDAAMTVAVKMLKPSAHSTEREALMSELKVLSYLGNHENIVNLLGACTHGGPTLVITEYCCYG 
           ____________________________________595___601_____________________________________________649____________________672____ 

           __________________________________________________________________806____813____________________________________________ 
 8s13(A) : DLLNFLRRKRDEFVPYK-------dFLTLEHLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGNITKICDFGLARDIKNDSNYVDKGNARLPVKWMAPESIFNSVYTFESDVWSYGI 
         :                                                                                                                          
 8s16(A) : DLLNFLRRKRDEFVPYKVpEDLYKDFLTLEHLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGNITKICDFGLARDIKNDSNYVDKGNARLPVKWMAPESIFNSVYTFESDVWSYGI 
           __________________________________________________________________806____813____________________________________________ 

           ___________________________________________________________________________                                              
 8s13(A) : FLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMSSPEYAPAEMYDIMKTCWDADPDKRPTFKQIVQDIEKQISES*                                              
         :                                                                                                                          
 8s16(A) : FLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMSSPEYAPAEMYDIMKTCWDADPDKRPTFKQIVQDIEKQISEST                                              
           ___________________________________________________________________________                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.8
Translation
(A) 		-0.5
Closure
(%) 		64.7
Bending Residues
( green ) 		  595 - 596
  601 - 602
  649 - 655
  672 - 675
  806 - 807
  813 - 822
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download