Splicing Factor, Proline- And Glutamine-Rich

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Splicing Factor, Proline- And Glutamine-Rich
  Conformer 1
(PDB) 		6ncq (A)
  Conformer 2
(PDB) 		4wii (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 139 0.55   285 - 298   317 - 322   324 - 327   339 - 355   362 - 459
2 36 0.45   299 - 316   323 - 323   328 - 338   356 - 361
3 29 0.37   473 - 501
4 25 0.35   502 - 526

Sequence


           ____________________298_______________316___322_____________338______________355___361__________________________________ 
 6ncq(A) : ***KANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFG 
         :                                                                                                                          
 4wii(A) : EGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFG 
           ____________________298_______________316___322_____________338______________355___361__________________________________ 

           _____________________________________________________________459_______________________________________501______________ 
 6ncq(A) : PIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDA 
         :                                                                                                                          
 4wii(A) : PIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDA 
           _____________________________________________________________459_______________________________________501______________ 

           ____________________                                                                                                     
 6ncq(A) : KDKLESEMEDAYHEHQANLL                                                                                                     
         :                                                                                                                          
 4wii(A) : KDKLESEMEDAYH*******                                                                                                     
           ____________________                                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 6.6 0.3 88.9   298 - 299   316 - 318   322 - 328   338 - 339   355 - 356   361 - 362 Bending Region Analysis
1 3 4.3 0.2 96.8   459 - 476 Bending Region Analysis
4 3 7.7 -0.4 80.1   501 - 502 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download